BMP-15 (Bone morphogenetic protein-15), Human
Bone morphogenetic protein 15 is a protein, that in humans, is encoded by the BMP15 gene. It's mainly involved in folliculogenesis. The protein encoded by this gene is a member of the TGF-β superfamily. It is a paracrine signaling molecule involved in oocyte and follicular development. Using Northern blot analysis, BMP15 has been shown to be exclusively expressed in the ovaries. This protein may be involved in oocyte maturation and follicular development as a homodimer or by forming heterodimers with a related protein, Gdf9.
Sequence:
MQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCV
PYKYVPISVLMIEANGSILYKEYEGMIAESCTCR with polyhistidine tag at the C-terminus
UnitProt ID:
O95972
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <17 ng/mL.
Purity:
>98% as determined by SDS-PAGE.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in 4 mM HCl to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
MQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCV
PYKYVPISVLMIEANGSILYKEYEGMIAESCTCR with polyhistidine tag at the C-terminus
UnitProt ID:
O95972
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <17 ng/mL.
Purity:
>98% as determined by SDS-PAGE.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in 4 mM HCl to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <17 ng/mL.